PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011079184.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family M-type_MADS
Protein Properties Length: 254aa    MW: 29018.9 Da    PI: 6.1704
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011079184.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.72e-251059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    rien + rqvt++kR+ gi KKA+ELSvLCd++va+i+fs+tg+l  ++s
  XP_011079184.1 10 RIENPTSRQVTYAKRKDGIVKKANELSVLCDTDVALIMFSPTGRLTSFAS 59
                    8*********************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-34160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006627.978161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.49E-27275IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-23323IPR002100Transcription factor, MADS-box
PfamPF003199.7E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-232338IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-233859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MGRKKLAMRR IENPTSRQVT YAKRKDGIVK KANELSVLCD TDVALIMFSP TGRLTSFASN  60
GRVEDIFLRF VDRPDELRGG PINNEEFLSQ RLKQLKYEGE MLEKIAIIED LEEKLDKLNR  120
KQRESQEKMR YYEPDIEKIN SVLEGGVYQQ FLTSALQRIQ LSKAKLLGNQ LIHERNENAE  180
MQAATVQMED AVSVTDHSID GNQNGMNSMR DIEDQNGTSL SMGPHLSLSF IEAQKHFKKL  240
QGSELSTPSF DNYN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-15178179Myocyte-specific enhancer factor 2B
1tqe_Q4e-15178179Myocyte-specific enhancer factor 2B
1tqe_R4e-15178179Myocyte-specific enhancer factor 2B
1tqe_S4e-15178179Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011079184.10.0PREDICTED: truncated transcription factor CAULIFLOWER A-like
TrEMBLA0A061E2G22e-76A0A061E2G2_THECC; AGAMOUS-like 66 isoform 1
TrEMBLA0A061E3M23e-77A0A061E3M2_THECC; AGAMOUS-like 66 isoform 4
STRINGSolyc07g052700.2.12e-49(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52921836
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.16e-38AGAMOUS-like 104